Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 756705..757236 Replicon chromosome
Accession NZ_LR882497
Organism Mycobacterium tuberculosis variant microti strain Maus IV isolate human

Toxin (Protein)


Gene name mazF Uniprot ID P9WII0
Locus tag JN995_RS03460 Protein ID WP_003403376.1
Coordinates 756705..757013 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag JN995_RS03465 Protein ID WP_072515591.1
Coordinates 757000..757236 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN995_RS03435 752020..753525 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
JN995_RS03440 753606..754616 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
JN995_RS03445 755004..755387 - 384 WP_003403365.1 ribonuclease VapC6 -
JN995_RS03450 755482..755637 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin -
JN995_RS03455 755713..756429 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
JN995_RS03460 756705..757013 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
JN995_RS03465 757000..757236 - 237 WP_072515591.1 ribbon-helix-helix protein, CopG family Antitoxin
JN995_RS03470 757346..757783 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
JN995_RS03475 757780..758034 - 255 WP_003911263.1 antitoxin VapB7 -
JN995_RS03480 758148..760511 + 2364 WP_003403397.1 arylsulfatase AtsD -
JN995_RS03485 760574..760900 + 327 WP_003403401.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
JN995_RS03490 760812..761150 + 339 WP_003403405.1 PIN domain-containing protein -
JN995_RS03495 761147..761320 + 174 WP_003898549.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-101)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11320.10 Da        Isoelectric Point: 11.6554

>T289733 WP_003403376.1 NZ_LR882497:c757013-756705 [Mycobacterium tuberculosis variant microti]
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC

Download         Length: 309 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8796.63 Da        Isoelectric Point: 4.2766

>AT289733 WP_072515591.1 NZ_LR882497:c757236-757000 [Mycobacterium tuberculosis variant microti]
MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENALAEIADWGPAEDWADAAR

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSE5

Antitoxin

Source ID Structure

References