Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 712268..712893 | Replicon | chromosome |
| Accession | NZ_LR882497 | ||
| Organism | Mycobacterium tuberculosis variant microti strain Maus IV isolate human | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQA0 |
| Locus tag | JN995_RS03225 | Protein ID | WP_003403218.1 |
| Coordinates | 712492..712893 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | JN995_RS03220 | Protein ID | WP_105799908.1 |
| Coordinates | 712268..712495 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN995_RS03195 | 707432..707653 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
| JN995_RS03200 | 707795..708400 | + | 606 | WP_105799909.1 | hypothetical protein | - |
| JN995_RS03205 | 708419..710986 | - | 2568 | WP_003900188.1 | SEC-C domain-containing protein | - |
| JN995_RS03210 | 711070..711834 | + | 765 | WP_202582124.1 | hypothetical protein | - |
| JN995_RS03215 | 711831..712073 | + | 243 | WP_003403210.1 | hypothetical protein | - |
| JN995_RS03220 | 712268..712495 | + | 228 | WP_105799908.1 | antitoxin | Antitoxin |
| JN995_RS03225 | 712492..712893 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
| JN995_RS03230 | 713022..713105 | + | 84 | Protein_640 | galactose-1-phosphate uridylyltransferase | - |
| JN995_RS03235 | 713124..714206 | + | 1083 | WP_031652152.1 | galactose-1-phosphate uridylyltransferase | - |
| JN995_RS03240 | 714203..715294 | + | 1092 | WP_003403225.1 | galactokinase | - |
| JN995_RS03245 | 715689..716846 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
| JN995_RS03250 | 716857..717804 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T289729 WP_003403218.1 NZ_LR882497:712492-712893 [Mycobacterium tuberculosis variant microti]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|