289727

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 698626..699272 Replicon chromosome
Accession NZ_LR882497
Organism Mycobacterium tuberculosis variant microti strain Maus IV isolate human

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag JN995_RS03120 Protein ID WP_003403137.1
Coordinates 698626..699039 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag JN995_RS03125 Protein ID WP_003403139.1
Coordinates 699036..699272 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN995_RS03100 694709..696259 + 1551 WP_003403119.1 MCE family protein -
JN995_RS03105 696311..696703 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
JN995_RS03110 696700..696957 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
JN995_RS03115 697140..698375 - 1236 WP_003403128.1 ATP-binding protein -
JN995_RS03120 698626..699039 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
JN995_RS03125 699036..699272 - 237 WP_003403139.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JN995_RS03130 699376..699882 - 507 WP_003900973.1 two component system sensor kinase HK1 -
JN995_RS03135 699996..700525 - 530 Protein_621 two component system sensor kinase HK2 -
JN995_RS03140 700509..701204 - 696 WP_003918099.1 two-component system response regulator TcrA -
JN995_RS03145 701327..701638 + 312 WP_003403164.1 hypothetical protein -
JN995_RS03150 701710..702660 + 951 WP_003907436.1 DUF1259 domain-containing protein -
JN995_RS03155 702901..703485 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
JN995_RS03160 703487..704200 + 714 Protein_626 IS607 family element transposase accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T289727 WP_003403137.1 NZ_LR882497:c699039-698626 [Mycobacterium tuberculosis variant microti]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT289727 WP_003403139.1 NZ_LR882497:c699272-699036 [Mycobacterium tuberculosis variant microti]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References