Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 3773123..3773790 | Replicon | chromosome |
Accession | NZ_LR882496 | ||
Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O50411 |
Locus tag | JN993_RS17540 | Protein ID | WP_003417916.1 |
Coordinates | 3773123..3773515 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8U8S7 |
Locus tag | JN993_RS17545 | Protein ID | WP_003912214.1 |
Coordinates | 3773515..3773790 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN993_RS17525 | 3768493..3770331 | - | 1839 | WP_105799903.1 | 1-deoxy-D-xylulose-5-phosphate synthase | - |
JN993_RS17530 | 3770328..3771317 | - | 990 | WP_003417912.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
JN993_RS17535 | 3771317..3772369 | - | 1053 | WP_003900678.1 | polyprenyl synthetase family protein | - |
JN993_RS17540 | 3773123..3773515 | - | 393 | WP_003417916.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JN993_RS17545 | 3773515..3773790 | - | 276 | WP_003912214.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
JN993_RS17550 | 3774002..3775343 | + | 1342 | Protein_3466 | ISNCY family transposase | - |
JN993_RS17555 | 3775533..3777794 | + | 2262 | WP_031667118.1 | PE family protein | - |
JN993_RS17560 | 3777865..3778737 | - | 873 | WP_003417929.1 | 3-hydroxyacyl-thioester dehydratase HtdY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3774666..3775343 | 677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14316.74 Da Isoelectric Point: 10.7249
>T289718 WP_003417916.1 NZ_LR882496:c3773515-3773123 [Mycobacterium tuberculosis variant microti]
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BXS8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E8U8S7 |