Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3172300..3172987 | Replicon | chromosome |
Accession | NZ_LR882496 | ||
Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P65044 |
Locus tag | JN993_RS14905 | Protein ID | WP_003414624.1 |
Coordinates | 3172544..3172987 (+) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TFH0 |
Locus tag | JN993_RS14900 | Protein ID | WP_003414620.1 |
Coordinates | 3172300..3172557 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN993_RS14880 | 3167620..3168474 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
JN993_RS14885 | 3168530..3169693 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
JN993_RS14890 | 3169710..3170924 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
JN993_RS14895 | 3170932..3172173 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
JN993_RS14900 | 3172300..3172557 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JN993_RS14905 | 3172544..3172987 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JN993_RS14910 | 3173067..3173729 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
JN993_RS14915 | 3173825..3174016 | + | 192 | WP_105799616.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
JN993_RS14920 | 3174348..3176096 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
JN993_RS14925 | 3176192..3176773 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
JN993_RS14930 | 3176873..3177139 | + | 267 | WP_031652375.1 | DUF2631 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T289714 WP_003414624.1 NZ_LR882496:3172544-3172987 [Mycobacterium tuberculosis variant microti]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|