Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3100839..3101409 | Replicon | chromosome |
Accession | NZ_LR882496 | ||
Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P71650 |
Locus tag | JN993_RS14530 | Protein ID | WP_003414166.1 |
Coordinates | 3100839..3101195 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL61 |
Locus tag | JN993_RS14535 | Protein ID | WP_003901465.1 |
Coordinates | 3101179..3101409 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN993_RS14510 | 3096291..3097979 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
JN993_RS14515 | 3097983..3098309 | - | 327 | WP_003414157.1 | hypothetical protein | - |
JN993_RS14520 | 3098482..3099069 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
JN993_RS14525 | 3099088..3100737 | + | 1650 | WP_105799646.1 | CocE/NonD family hydrolase | - |
JN993_RS14530 | 3100839..3101195 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
JN993_RS14535 | 3101179..3101409 | - | 231 | WP_003901465.1 | antitoxin MazE | Antitoxin |
JN993_RS14540 | 3101452..3102495 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
JN993_RS14545 | 3102686..3102961 | + | 276 | WP_003911993.1 | DUF1778 domain-containing protein | - |
JN993_RS14550 | 3103137..3103391 | - | 255 | WP_003917684.1 | hypothetical protein | - |
JN993_RS14555 | 3103539..3103943 | + | 405 | WP_003414181.1 | hypothetical protein | - |
JN993_RS14560 | 3103940..3104131 | + | 192 | WP_003414184.1 | hypothetical protein | - |
JN993_RS14565 | 3104195..3105484 | + | 1290 | Protein_2874 | transposase family protein | - |
JN993_RS14570 | 3105718..3105975 | + | 258 | WP_003899489.1 | hypothetical protein | - |
JN993_RS14575 | 3106080..3106391 | + | 312 | WP_003414190.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T289710 WP_003414166.1 NZ_LR882496:c3101195-3100839 [Mycobacterium tuberculosis variant microti]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|