Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 2860650..2861281 | Replicon | chromosome |
| Accession | NZ_LR882496 | ||
| Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ28 |
| Locus tag | JN993_RS13215 | Protein ID | WP_003413174.1 |
| Coordinates | 2860904..2861281 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P95006 |
| Locus tag | JN993_RS13210 | Protein ID | WP_003413167.1 |
| Coordinates | 2860650..2860907 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN993_RS13180 | 2856564..2856878 | + | 315 | WP_009937839.1 | hypothetical protein | - |
| JN993_RS13185 | 2857174..2858385 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
| JN993_RS13190 | 2858512..2859171 | + | 660 | WP_031719937.1 | LppA family lipoprotein | - |
| JN993_RS13195 | 2859168..2859830 | + | 663 | WP_052624433.1 | hypothetical protein | - |
| JN993_RS13200 | 2859827..2860105 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| JN993_RS13205 | 2860198..2860611 | + | 414 | WP_003413164.1 | PIN domain nuclease | - |
| JN993_RS13210 | 2860650..2860907 | + | 258 | WP_003413167.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| JN993_RS13215 | 2860904..2861281 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JN993_RS13220 | 2861297..2861671 | - | 375 | WP_003413177.1 | hypothetical protein | - |
| JN993_RS13225 | 2861771..2862166 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
| JN993_RS13230 | 2862163..2862408 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
| JN993_RS13235 | 2862819..2863238 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
| JN993_RS13240 | 2863250..2864059 | - | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
| JN993_RS13245 | 2864056..2865324 | - | 1269 | WP_202582048.1 | endolytic transglycosylase MltG | - |
| JN993_RS13250 | 2865317..2865829 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13728.72 Da Isoelectric Point: 4.4687
>T289704 WP_003413174.1 NZ_LR882496:2860904-2861281 [Mycobacterium tuberculosis variant microti]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ28 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C9W5 |