Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2860198..2860907 | Replicon | chromosome |
Accession | NZ_LR882496 | ||
Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ26 |
Locus tag | JN993_RS13205 | Protein ID | WP_003413164.1 |
Coordinates | 2860198..2860611 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P95006 |
Locus tag | JN993_RS13210 | Protein ID | WP_003413167.1 |
Coordinates | 2860650..2860907 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN993_RS13175 | 2855251..2856456 | - | 1206 | WP_003413027.1 | chorismate synthase | - |
JN993_RS13180 | 2856564..2856878 | + | 315 | WP_009937839.1 | hypothetical protein | - |
JN993_RS13185 | 2857174..2858385 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
JN993_RS13190 | 2858512..2859171 | + | 660 | WP_031719937.1 | LppA family lipoprotein | - |
JN993_RS13195 | 2859168..2859830 | + | 663 | WP_052624433.1 | hypothetical protein | - |
JN993_RS13200 | 2859827..2860105 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
JN993_RS13205 | 2860198..2860611 | + | 414 | WP_003413164.1 | PIN domain nuclease | Toxin |
JN993_RS13210 | 2860650..2860907 | + | 258 | WP_003413167.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JN993_RS13215 | 2860904..2861281 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | - |
JN993_RS13220 | 2861297..2861671 | - | 375 | WP_003413177.1 | hypothetical protein | - |
JN993_RS13225 | 2861771..2862166 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
JN993_RS13230 | 2862163..2862408 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
JN993_RS13235 | 2862819..2863238 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
JN993_RS13240 | 2863250..2864059 | - | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
JN993_RS13245 | 2864056..2865324 | - | 1269 | WP_202582048.1 | endolytic transglycosylase MltG | - |
JN993_RS13250 | 2865317..2865829 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15045.00 Da Isoelectric Point: 5.4673
>T289703 WP_003413164.1 NZ_LR882496:2860198-2860611 [Mycobacterium tuberculosis variant microti]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ26 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C9W5 |