289703

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2860198..2860907 Replicon chromosome
Accession NZ_LR882496
Organism Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag JN993_RS13205 Protein ID WP_003413164.1
Coordinates 2860198..2860611 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag JN993_RS13210 Protein ID WP_003413167.1
Coordinates 2860650..2860907 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN993_RS13175 2855251..2856456 - 1206 WP_003413027.1 chorismate synthase -
JN993_RS13180 2856564..2856878 + 315 WP_009937839.1 hypothetical protein -
JN993_RS13185 2857174..2858385 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
JN993_RS13190 2858512..2859171 + 660 WP_031719937.1 LppA family lipoprotein -
JN993_RS13195 2859168..2859830 + 663 WP_052624433.1 hypothetical protein -
JN993_RS13200 2859827..2860105 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
JN993_RS13205 2860198..2860611 + 414 WP_003413164.1 PIN domain nuclease Toxin
JN993_RS13210 2860650..2860907 + 258 WP_003413167.1 ribbon-helix-helix domain-containing protein Antitoxin
JN993_RS13215 2860904..2861281 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
JN993_RS13220 2861297..2861671 - 375 WP_003413177.1 hypothetical protein -
JN993_RS13225 2861771..2862166 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
JN993_RS13230 2862163..2862408 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
JN993_RS13235 2862819..2863238 - 420 WP_003413190.1 A24 family peptidase -
JN993_RS13240 2863250..2864059 - 810 WP_003413193.1 shikimate dehydrogenase -
JN993_RS13245 2864056..2865324 - 1269 WP_202582048.1 endolytic transglycosylase MltG -
JN993_RS13250 2865317..2865829 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T289703 WP_003413164.1 NZ_LR882496:2860198-2860611 [Mycobacterium tuberculosis variant microti]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT289703 WP_003413167.1 NZ_LR882496:2860650-2860907 [Mycobacterium tuberculosis variant microti]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References