Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mbcAT/RES-TIGR02293 |
Location | 2225062..2225960 | Replicon | chromosome |
Accession | NZ_LR882496 | ||
Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole |
Toxin (Protein)
Gene name | mbcT | Uniprot ID | P64908 |
Locus tag | JN993_RS10260 | Protein ID | WP_003410001.1 |
Coordinates | 2225062..2225622 (-) | Length | 187 a.a. |
Antitoxin (Protein)
Gene name | mbcA | Uniprot ID | P64910 |
Locus tag | JN993_RS10265 | Protein ID | WP_003410003.1 |
Coordinates | 2225619..2225960 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN993_RS10230 | 2220231..2220884 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
JN993_RS10235 | 2220999..2221229 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
JN993_RS10240 | 2221314..2222225 | - | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
JN993_RS10245 | 2222334..2222933 | + | 600 | WP_003409989.1 | L-lysine exporter | - |
JN993_RS10250 | 2223349..2223777 | + | 429 | WP_003409992.1 | cellulose-binding protein | - |
JN993_RS10255 | 2224003..2224542 | + | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
JN993_RS10260 | 2225062..2225622 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | Toxin |
JN993_RS10265 | 2225619..2225960 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | Antitoxin |
JN993_RS10270 | 2226046..2226303 | + | 258 | WP_003410006.1 | hypothetical protein | - |
JN993_RS10275 | 2226204..2226539 | - | 336 | WP_003410009.1 | dehydrogenase | - |
JN993_RS10280 | 2226628..2226972 | - | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | - |
JN993_RS10285 | 2226966..2227214 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | - |
JN993_RS10290 | 2227314..2229629 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
JN993_RS10295 | 2229626..2229898 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
JN993_RS10300 | 2229951..2230307 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 187 a.a. Molecular weight: 20248.70 Da Isoelectric Point: 4.5091
>T289694 WP_003410001.1 NZ_LR882496:c2225622-2225062 [Mycobacterium tuberculosis variant microti]
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
Download Length: 561 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12488.33 Da Isoelectric Point: 4.8359
>AT289694 WP_003410003.1 NZ_LR882496:c2225960-2225619 [Mycobacterium tuberculosis variant microti]
MGVNVLASTVSGAIERLGLTYEEVGDIVDASPRSVARWTAGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLEHRKPADLVRDGEYQRVLALIDAMAEGVFV
MGVNVLASTVSGAIERLGLTYEEVGDIVDASPRSVARWTAGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLEHRKPADLVRDGEYQRVLALIDAMAEGVFV
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|