Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2217736..2218424 | Replicon | chromosome |
Accession | NZ_LR882496 | ||
Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0A653 |
Locus tag | JN993_RS10215 | Protein ID | WP_003409958.1 |
Coordinates | 2217736..2218155 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ28 |
Locus tag | JN993_RS10220 | Protein ID | WP_003409968.1 |
Coordinates | 2218164..2218424 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN993_RS10190 | 2212740..2213045 | + | 306 | Protein_2013 | ABC transporter permease | - |
JN993_RS10195 | 2213229..2214079 | + | 851 | Protein_2014 | class I SAM-dependent methyltransferase | - |
JN993_RS10200 | 2214042..2215487 | - | 1446 | WP_003409946.1 | APC family permease | - |
JN993_RS10205 | 2215666..2216352 | - | 687 | WP_003409954.1 | immunoprotective protein Mpt64 | - |
JN993_RS10210 | 2216543..2217511 | - | 969 | WP_003409956.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
JN993_RS10215 | 2217736..2218155 | - | 420 | WP_003409958.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JN993_RS10220 | 2218164..2218424 | - | 261 | WP_003409968.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
JN993_RS10225 | 2218567..2220243 | + | 1677 | WP_003899118.1 | PecA family PE domain-processing aspartic protease | - |
JN993_RS10230 | 2220231..2220884 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
JN993_RS10235 | 2220999..2221229 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
JN993_RS10240 | 2221314..2222225 | - | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
JN993_RS10245 | 2222334..2222933 | + | 600 | WP_003409989.1 | L-lysine exporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14724.89 Da Isoelectric Point: 7.9535
>T289693 WP_003409958.1 NZ_LR882496:c2218155-2217736 [Mycobacterium tuberculosis variant microti]
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C4H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C483 |