Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 1970471..1970931 | Replicon | chromosome |
Accession | NZ_LR882496 | ||
Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A7U4FB26 |
Locus tag | JN993_RS09055 | Protein ID | WP_003408531.1 |
Coordinates | 1970683..1970931 (+) | Length | 83 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ30 |
Locus tag | JN993_RS09050 | Protein ID | WP_003408528.1 |
Coordinates | 1970471..1970683 (+) | Length | 71 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN993_RS09035 | 1966949..1968136 | - | 1188 | WP_003898992.1 | nitrate transporter NarK | - |
JN993_RS09040 | 1968423..1968707 | + | 285 | WP_003408522.1 | DUF1876 domain-containing protein | - |
JN993_RS09045 | 1968721..1970403 | - | 1683 | WP_003898994.1 | SulP family inorganic anion transporter | - |
JN993_RS09050 | 1970471..1970683 | + | 213 | WP_003408528.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
JN993_RS09055 | 1970683..1970931 | + | 249 | WP_003408531.1 | hypothetical protein | Toxin |
JN993_RS09060 | 1970939..1971677 | + | 739 | Protein_1788 | hypothetical protein | - |
JN993_RS09065 | 1971771..1973471 | + | 1701 | WP_003898998.1 | serine/threonine protein kinase PknE | - |
JN993_RS09070 | 1973756..1974157 | - | 402 | WP_003408538.1 | hypothetical protein | - |
JN993_RS09075 | 1974147..1974758 | - | 612 | WP_003898999.1 | isopentenyl-diphosphate Delta-isomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 83 a.a. Molecular weight: 8857.07 Da Isoelectric Point: 3.9794
>T289689 WP_003408531.1 NZ_LR882496:1970683-1970931 [Mycobacterium tuberculosis variant microti]
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYTGDDFACIDIRAVL
AG
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYTGDDFACIDIRAVL
AG
Download Length: 249 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FB26 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CFE8 |