Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1776574..1777187 | Replicon | chromosome |
Accession | NZ_LR882496 | ||
Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64880 |
Locus tag | JN993_RS08205 | Protein ID | WP_003407786.1 |
Coordinates | 1776783..1777187 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8UJ46 |
Locus tag | JN993_RS08200 | Protein ID | WP_009935474.1 |
Coordinates | 1776574..1776777 (+) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN993_RS08185 | 1771838..1774741 | + | 2904 | WP_003407779.1 | MMPL family transporter | - |
JN993_RS08190 | 1774751..1775197 | + | 447 | WP_003407780.1 | F420H(2)-dependent quinone reductase | - |
JN993_RS08195 | 1775232..1776521 | + | 1290 | WP_003407781.1 | threonine ammonia-lyase | - |
JN993_RS08200 | 1776574..1776777 | + | 204 | WP_009935474.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
JN993_RS08205 | 1776783..1777187 | + | 405 | WP_003407786.1 | type II toxin-antitoxin system toxin ribonuclease VapC11 | Toxin |
JN993_RS08210 | 1777204..1778946 | - | 1743 | WP_003407788.1 | malto-oligosyltrehalose trehalohydrolase | - |
JN993_RS08215 | 1778939..1781236 | - | 2298 | WP_105799702.1 | malto-oligosyltrehalose synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14650.76 Da Isoelectric Point: 5.6587
>T289687 WP_003407786.1 NZ_LR882496:1776783-1777187 [Mycobacterium tuberculosis variant microti]
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|