Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1694559..1695175 | Replicon | chromosome |
| Accession | NZ_LR882496 | ||
| Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TJ74 |
| Locus tag | JN993_RS07845 | Protein ID | WP_003407593.1 |
| Coordinates | 1694858..1695175 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TJ73 |
| Locus tag | JN993_RS07840 | Protein ID | WP_003900349.1 |
| Coordinates | 1694559..1694861 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN993_RS07830 | 1690445..1692292 | + | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
| JN993_RS07835 | 1692293..1694545 | + | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
| JN993_RS07840 | 1694559..1694861 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
| JN993_RS07845 | 1694858..1695175 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
| JN993_RS07850 | 1695172..1696176 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
| JN993_RS07855 | 1696229..1697518 | + | 1290 | WP_003407599.1 | serine hydrolase | - |
| JN993_RS07860 | 1697591..1698364 | - | 774 | WP_003912632.1 | class I SAM-dependent methyltransferase | - |
| JN993_RS07865 | 1698422..1698613 | - | 192 | WP_003407609.1 | dodecin family protein | - |
| JN993_RS07870 | 1698644..1698868 | - | 225 | WP_160522526.1 | NUDIX domain-containing protein | - |
| JN993_RS07875 | 1699138..1700166 | + | 1029 | WP_003407612.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T289686 WP_003407593.1 NZ_LR882496:1694858-1695175 [Mycobacterium tuberculosis variant microti]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11173.42 Da Isoelectric Point: 9.5564
>AT289686 WP_003900349.1 NZ_LR882496:1694559-1694861 [Mycobacterium tuberculosis variant microti]
VPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDEQLDAAYAAAIHDNPAYPYES
EAERSAARARRNARQQRSAQ
VPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDEQLDAAYAAAIHDNPAYPYES
EAERSAARARRNARQQRSAQ
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|