Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1387288..1387976 | Replicon | chromosome |
| Accession | NZ_LR882496 | ||
| Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0THR7 |
| Locus tag | JN993_RS06500 | Protein ID | WP_003406304.1 |
| Coordinates | 1387545..1387976 (+) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0THR6 |
| Locus tag | JN993_RS06495 | Protein ID | WP_003406302.1 |
| Coordinates | 1387288..1387548 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN993_RS06475 | 1382865..1383689 | + | 825 | WP_003900298.1 | trehalose ABC transporter permease SugB | - |
| JN993_RS06480 | 1383694..1384875 | + | 1182 | WP_202589887.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
| JN993_RS06485 | 1384952..1386052 | - | 1101 | WP_003406300.1 | magnesium/cobalt transporter CorA | - |
| JN993_RS06490 | 1386223..1387212 | + | 990 | WP_003406301.1 | malate dehydrogenase | - |
| JN993_RS06495 | 1387288..1387548 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | Antitoxin |
| JN993_RS06500 | 1387545..1387976 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JN993_RS06505 | 1387999..1389687 | - | 1689 | WP_003910308.1 | PE family protein | - |
| JN993_RS06510 | 1389867..1390727 | + | 861 | WP_003406306.1 | hypothetical protein | - |
| JN993_RS06515 | 1390808..1391638 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| JN993_RS06520 | 1391695..1391988 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | - |
| JN993_RS06525 | 1391985..1392254 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15873.08 Da Isoelectric Point: 5.8838
>T289682 WP_003406304.1 NZ_LR882496:1387545-1387976 [Mycobacterium tuberculosis variant microti]
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|