Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 843821..844530 | Replicon | chromosome |
| Accession | NZ_LR882496 | ||
| Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | JN993_RS03940 | Protein ID | WP_055368821.1 |
| Coordinates | 844102..844530 (+) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TEX4 |
| Locus tag | JN993_RS03935 | Protein ID | WP_003403834.1 |
| Coordinates | 843821..844078 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN993_RS03925 | 840930..842108 | + | 1179 | Protein_776 | PE family protein | - |
| JN993_RS03930 | 842141..843730 | + | 1590 | Protein_777 | PE family protein | - |
| JN993_RS03935 | 843821..844078 | + | 258 | WP_003403834.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| JN993_RS03940 | 844102..844530 | + | 429 | WP_055368821.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JN993_RS03945 | 844620..844794 | - | 175 | Protein_780 | transposase | - |
| JN993_RS03950 | 844907..845152 | + | 246 | WP_003403841.1 | hypothetical protein | - |
| JN993_RS03955 | 845221..846105 | - | 885 | WP_003403844.1 | 3-hydroxyisobutyrate dehydrogenase | - |
| JN993_RS03960 | 846116..847288 | - | 1173 | WP_003403845.1 | acyl-CoA dehydrogenase FadE9 | - |
| JN993_RS03965 | 847295..848827 | - | 1533 | WP_003403847.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15844.27 Da Isoelectric Point: 7.5536
>T289676 WP_055368821.1 NZ_LR882496:844102-844530 [Mycobacterium tuberculosis variant microti]
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVNAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVNAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|