Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 757544..758232 | Replicon | chromosome |
Accession | NZ_LR882496 | ||
Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFB2 |
Locus tag | JN993_RS03465 | Protein ID | WP_003403386.1 |
Coordinates | 757544..757981 (-) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | O06777 |
Locus tag | JN993_RS03470 | Protein ID | WP_003911263.1 |
Coordinates | 757978..758232 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN993_RS03435 | 753795..754805 | + | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
JN993_RS03440 | 755193..755576 | - | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
JN993_RS03445 | 755671..755826 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
JN993_RS03450 | 755902..756618 | - | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
JN993_RS03455 | 756894..757202 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
JN993_RS03460 | 757189..757434 | - | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | - |
JN993_RS03465 | 757544..757981 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JN993_RS03470 | 757978..758232 | - | 255 | WP_003911263.1 | antitoxin VapB7 | Antitoxin |
JN993_RS03475 | 758346..760709 | + | 2364 | WP_105799810.1 | arylsulfatase AtsD | - |
JN993_RS03480 | 760772..761098 | + | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
JN993_RS03485 | 761010..761348 | + | 339 | WP_003403405.1 | PIN domain-containing protein | - |
JN993_RS03490 | 761345..761518 | + | 174 | WP_003898549.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15245.39 Da Isoelectric Point: 5.1865
>T289675 WP_003403386.1 NZ_LR882496:c757981-757544 [Mycobacterium tuberculosis variant microti]
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSW5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806JQG1 |