Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 719701..720365 | Replicon | chromosome |
Accession | NZ_LR882496 | ||
Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P96917 |
Locus tag | JN993_RS03270 | Protein ID | WP_003403246.1 |
Coordinates | 719958..720365 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WF18 |
Locus tag | JN993_RS03265 | Protein ID | WP_003403244.1 |
Coordinates | 719701..719961 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN993_RS03240 | 715878..717035 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
JN993_RS03245 | 717046..717993 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
JN993_RS03250 | 718086..718340 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | - |
JN993_RS03255 | 718340..718735 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | - |
JN993_RS03260 | 718829..719569 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
JN993_RS03265 | 719701..719961 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
JN993_RS03270 | 719958..720365 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JN993_RS03275 | 720437..721588 | - | 1152 | WP_003403248.1 | FIST C-terminal domain-containing protein | - |
JN993_RS03280 | 721681..723408 | - | 1728 | WP_003900979.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14376.37 Da Isoelectric Point: 4.3568
>T289671 WP_003403246.1 NZ_LR882496:719958-720365 [Mycobacterium tuberculosis variant microti]
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|