Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 712457..713082 | Replicon | chromosome |
Accession | NZ_LR882496 | ||
Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQA0 |
Locus tag | JN993_RS03220 | Protein ID | WP_003403218.1 |
Coordinates | 712681..713082 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | JN993_RS03215 | Protein ID | WP_105799908.1 |
Coordinates | 712457..712684 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN993_RS03190 | 707636..707857 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
JN993_RS03195 | 707999..708604 | + | 606 | WP_105799909.1 | hypothetical protein | - |
JN993_RS03200 | 708623..711190 | - | 2568 | WP_003900188.1 | SEC-C domain-containing protein | - |
JN993_RS03205 | 711274..712023 | + | 750 | WP_003898528.1 | hypothetical protein | - |
JN993_RS03210 | 712020..712262 | + | 243 | WP_003403210.1 | hypothetical protein | - |
JN993_RS03215 | 712457..712684 | + | 228 | WP_105799908.1 | antitoxin | Antitoxin |
JN993_RS03220 | 712681..713082 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
JN993_RS03225 | 713211..713294 | + | 84 | Protein_639 | galactose-1-phosphate uridylyltransferase | - |
JN993_RS03230 | 713313..714395 | + | 1083 | WP_031652152.1 | galactose-1-phosphate uridylyltransferase | - |
JN993_RS03235 | 714392..715483 | + | 1092 | WP_003403225.1 | galactokinase | - |
JN993_RS03240 | 715878..717035 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
JN993_RS03245 | 717046..717993 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T289669 WP_003403218.1 NZ_LR882496:712681-713082 [Mycobacterium tuberculosis variant microti]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|