Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 704919..705562 | Replicon | chromosome |
| Accession | NZ_LR882496 | ||
| Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P67239 |
| Locus tag | JN993_RS03170 | Protein ID | WP_003403187.1 |
| Coordinates | 705161..705562 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ91 |
| Locus tag | JN993_RS03165 | Protein ID | WP_003403184.1 |
| Coordinates | 704919..705164 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN993_RS03130 | 700199..700729 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
| JN993_RS03135 | 700713..701408 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
| JN993_RS03140 | 701531..701842 | + | 312 | WP_003403164.1 | hypothetical protein | - |
| JN993_RS03145 | 701914..702864 | + | 951 | WP_003907436.1 | DUF1259 domain-containing protein | - |
| JN993_RS03150 | 703105..703689 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
| JN993_RS03155 | 703691..704404 | + | 714 | Protein_625 | IS607 family element transposase accessory protein TnpB | - |
| JN993_RS03160 | 704404..704874 | + | 471 | WP_003898523.1 | hypothetical protein | - |
| JN993_RS03165 | 704919..705164 | + | 246 | WP_003403184.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| JN993_RS03170 | 705161..705562 | + | 402 | WP_003403187.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JN993_RS03175 | 705950..706117 | - | 168 | WP_077385191.1 | DUF3800 domain-containing protein | - |
| JN993_RS03180 | 706150..706347 | - | 198 | WP_003403191.1 | hypothetical protein | - |
| JN993_RS03185 | 706427..707584 | - | 1158 | WP_003403193.1 | hypothetical protein | - |
| JN993_RS03190 | 707636..707857 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
| JN993_RS03195 | 707999..708604 | + | 606 | WP_105799909.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14501.21 Da Isoelectric Point: 4.4463
>T289668 WP_003403187.1 NZ_LR882496:705161-705562 [Mycobacterium tuberculosis variant microti]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ91 |