289659

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 6836..7337 Replicon plasmid 3
Accession NZ_LR882495
Organism Escherichia coli isolate 2016-17-292

Toxin (Protein)


Gene name TsxA Uniprot ID A0A6X6XTU7
Locus tag IHO92_RS24135 Protein ID WP_000702245.1
Coordinates 6836..7096 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag IHO92_RS24140 Protein ID WP_001132407.1
Coordinates 7086..7337 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IHO92_RS24095 2433..2594 + 162 WP_001366886.1 type I toxin-antitoxin system Hok family toxin -
IHO92_RS24100 2744..3340 + 597 WP_000125165.1 hypothetical protein -
IHO92_RS24105 3358..3642 - 285 WP_001162371.1 hypothetical protein -
IHO92_RS24110 3716..4381 - 666 WP_000532148.1 P-loop NTPase -
IHO92_RS24115 4979..5308 + 330 WP_000855121.1 hypothetical protein -
IHO92_RS24120 5889..6212 + 324 WP_000427402.1 hypothetical protein -
IHO92_RS24125 6253..6462 + 210 WP_000866037.1 hypothetical protein -
IHO92_RS24130 6560..6784 + 225 WP_000814383.1 hypothetical protein -
IHO92_RS24135 6836..7096 + 261 WP_000702245.1 hypothetical protein Toxin
IHO92_RS24140 7086..7337 + 252 WP_001132407.1 transcriptional regulator Antitoxin
IHO92_RS24145 7887..8165 + 279 WP_000545937.1 hypothetical protein -
IHO92_RS24150 8552..8734 - 183 WP_001401700.1 hypothetical protein -
IHO92_RS24155 9292..9474 + 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
IHO92_RS24160 9499..9936 + 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
IHO92_RS24165 10066..10386 - 321 WP_001401701.1 hypothetical protein -
IHO92_RS24170 10720..10898 - 179 Protein_16 hypothetical protein -
IHO92_RS24175 10900..11103 - 204 WP_000224735.1 hypothetical protein -
IHO92_RS24180 11109..11546 - 438 WP_000206706.1 hypothetical protein -
IHO92_RS24185 11566..12273 - 708 WP_000108795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..59944 59944


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9818.23 Da        Isoelectric Point: 9.5163

>T289659 WP_000702245.1 NZ_LR882495:6836-7096 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEEAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9404.77 Da        Isoelectric Point: 9.8120

>AT289659 WP_001132407.1 NZ_LR882495:7086-7337 [Escherichia coli]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6X6XTU7

Antitoxin

Source ID Structure

References