Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 53576..54123 Replicon plasmid 2
Accession NZ_LR882494
Organism Escherichia coli isolate 2016-17-292

Toxin (Protein)


Gene name parE Uniprot ID E9LLH3
Locus tag IHO92_RS23820 Protein ID WP_000969996.1
Coordinates 53576..53857 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag IHO92_RS23825 Protein ID WP_000079941.1
Coordinates 53854..54123 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IHO92_RS23790 49006..49266 + 261 WP_000343091.1 hypothetical protein -
IHO92_RS23795 49263..49853 + 591 WP_001350923.1 hypothetical protein -
IHO92_RS23800 49873..50130 - 258 WP_000142431.1 hypothetical protein -
IHO92_RS23805 50259..50594 + 336 WP_001080729.1 colicin 1A immunity protein -
IHO92_RS23810 50616..52496 - 1881 WP_001610315.1 colicin 1A -
IHO92_RS23815 52682..53530 - 849 WP_001057989.1 3'-5' exonuclease -
IHO92_RS23820 53576..53857 - 282 WP_000969996.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
IHO92_RS23825 53854..54123 - 270 WP_000079941.1 hypothetical protein Antitoxin
IHO92_RS23830 54196..54336 - 141 WP_012512742.1 hypothetical protein -
IHO92_RS23835 55039..55896 - 858 WP_001610316.1 incFII family plasmid replication initiator RepA -
IHO92_RS23840 55889..55963 - 75 WP_001365705.1 RepA leader peptide Tap -
IHO92_RS23845 56189..56449 - 261 WP_000083818.1 replication regulatory protein RepA -
IHO92_RS23850 56688..57278 - 591 WP_000766807.1 DUF2726 domain-containing protein -
IHO92_RS23855 57316..57525 - 210 WP_001610317.1 hemolysin expression modulator Hha -
IHO92_RS23860 57571..58032 - 462 WP_001233868.1 thermonuclease family protein -
IHO92_RS23865 58232..58483 - 252 WP_001372275.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..97083 97083


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-92)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10893.57 Da        Isoelectric Point: 8.4615

>T289654 WP_000969996.1 NZ_LR882494:c53857-53576 [Escherichia coli]
MMEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKV
YILRVLHTAQKWP

Download         Length: 282 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT289654 WP_000079941.1 NZ_LR882494:c54123-53854 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB E9LLH3

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References