Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 41617..41993 Replicon plasmid 2
Accession NZ_LR882494
Organism Escherichia coli isolate 2016-17-292

Toxin (Protein)


Gene name parE Uniprot ID A0A075MDK3
Locus tag IHO92_RS23740 Protein ID WP_000969988.1
Coordinates 41617..41799 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag IHO92_RS23745 Protein ID WP_001324224.1
Coordinates 41796..41993 (-) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IHO92_RS23725 38121..39349 + 1229 WP_088895425.1 IS3-like element IS2 family transposase -
IHO92_RS23730 39616..40650 - 1035 WP_001190234.1 3-deoxy-7-phosphoheptulonate synthase -
IHO92_RS23735 41210..41518 - 309 WP_000377483.1 hypothetical protein -
IHO92_RS23740 41617..41799 - 183 WP_000969988.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
IHO92_RS23745 41796..41993 - 198 WP_001324224.1 toxin-antitoxin system protein Antitoxin
IHO92_RS23750 42675..43949 + 1275 WP_000489608.1 HlyD family secretion protein -
IHO92_RS23755 43924..46038 + 2115 WP_001183604.1 peptidase domain-containing ABC transporter -
IHO92_RS23760 46208..46519 - 312 WP_001259758.1 colicin V -
IHO92_RS23765 46497..46733 - 237 WP_001323890.1 colicin V immunity protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..97083 97083


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6931.07 Da        Isoelectric Point: 4.5349

>T289653 WP_000969988.1 NZ_LR882494:c41799-41617 [Escherichia coli]
MMEIFWTMLASQDRKRIREYIAEQNLIAAIELDERIGCSASLLFSLSFISVQVHDNIITV

Download         Length: 183 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 7658.53 Da        Isoelectric Point: 7.2046

>AT289653 WP_001324224.1 NZ_LR882494:c41993-41796 [Escherichia coli]
MDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRDEMSRKVAGK

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A075MDK3

Antitoxin

Source ID Structure

References