Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4135682..4136502 | Replicon | chromosome |
Accession | NZ_LR882493 | ||
Organism | Escherichia coli isolate 2016-17-292 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | B6I030 |
Locus tag | IHO92_RS20265 | Protein ID | WP_001054379.1 |
Coordinates | 4135682..4135939 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | IHO92_RS20270 | Protein ID | WP_000123957.1 |
Coordinates | 4135951..4136502 (+) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHO92_RS20245 | 4130969..4132075 | + | 1107 | WP_001295733.1 | N-acetylneuraminate epimerase | - |
IHO92_RS20250 | 4132139..4133119 | + | 981 | WP_000991462.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
IHO92_RS20255 | 4133702..4134928 | - | 1227 | Protein_3961 | DNA helicase | - |
IHO92_RS20260 | 4135006..4135305 | + | 300 | WP_001332034.1 | GNAT family N-acetyltransferase | - |
IHO92_RS20265 | 4135682..4135939 | + | 258 | WP_001054379.1 | YjhX family toxin | Toxin |
IHO92_RS20270 | 4135951..4136502 | + | 552 | WP_000123957.1 | N-acetyltransferase | Antitoxin |
IHO92_RS20275 | 4136554..4137300 | + | 747 | WP_000354249.1 | class I SAM-dependent methyltransferase | - |
IHO92_RS20280 | 4137428..4137688 | + | 261 | WP_000077646.1 | hypothetical protein | - |
IHO92_RS20285 | 4137726..4137842 | + | 117 | Protein_3967 | VOC family protein | - |
IHO92_RS20290 | 4138087..4139208 | + | 1122 | WP_191519211.1 | M42 family metallopeptidase | - |
IHO92_RS20295 | 4139205..4139483 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
IHO92_RS20300 | 4139495..4140808 | + | 1314 | WP_000460845.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimE / fimB | 4127103..4144723 | 17620 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9568.07 Da Isoelectric Point: 11.1381
>T289650 WP_001054379.1 NZ_LR882493:4135682-4135939 [Escherichia coli]
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20358.34 Da Isoelectric Point: 6.4182
>AT289650 WP_000123957.1 NZ_LR882493:4135951-4136502 [Escherichia coli]
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|