Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1291388..1292013 | Replicon | chromosome |
| Accession | NZ_LR882493 | ||
| Organism | Escherichia coli isolate 2016-17-292 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | IHO92_RS06275 | Protein ID | WP_000911330.1 |
| Coordinates | 1291615..1292013 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | IHO92_RS06270 | Protein ID | WP_000450524.1 |
| Coordinates | 1291388..1291615 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IHO92_RS06245 | 1287191..1287661 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| IHO92_RS06250 | 1287661..1288233 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| IHO92_RS06255 | 1288379..1289257 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| IHO92_RS06260 | 1289274..1290308 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| IHO92_RS06265 | 1290521..1291234 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| IHO92_RS06270 | 1291388..1291615 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| IHO92_RS06275 | 1291615..1292013 | + | 399 | WP_000911330.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| IHO92_RS06280 | 1292160..1293023 | + | 864 | WP_094316634.1 | neutral zinc metallopeptidase | - |
| IHO92_RS06285 | 1293038..1295053 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| IHO92_RS06290 | 1295127..1295825 | + | 699 | WP_000679823.1 | esterase | - |
| IHO92_RS06295 | 1295935..1296135 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T289642 WP_000911330.1 NZ_LR882493:1291615-1292013 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|