Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 32018..32553 Replicon plasmid 3
Accession NZ_LR882059
Organism Escherichia coli isolate 2014-01-7375

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag IHP09_RS24730 Protein ID WP_001270421.1
Coordinates 32018..32305 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID L4J0V6
Locus tag IHP09_RS24735 Protein ID WP_001132895.1
Coordinates 32302..32553 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IHP09_RS24710 28689..28838 + 150 WP_064717472.1 hypothetical protein -
IHP09_RS24715 28959..29699 + 741 WP_001066927.1 tyrosine-type recombinase/integrase -
IHP09_RS24720 29984..30961 - 978 WP_001470054.1 RepB family plasmid replication initiator protein -
IHP09_RS24725 31605..32016 - 412 Protein_26 DDE-type integrase/transposase/recombinase -
IHP09_RS24730 32018..32305 - 288 WP_001270421.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
IHP09_RS24735 32302..32553 - 252 WP_001132895.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
IHP09_RS24740 32728..32940 - 213 WP_000402944.1 hypothetical protein -
IHP09_RS24745 33314..34519 + 1206 WP_000817642.1 AAA family ATPase -
IHP09_RS24750 34516..35478 + 963 WP_000756325.1 ParB/RepB/Spo0J family partition protein -
IHP09_RS24755 35619..35792 - 174 Protein_32 DUF4113 domain-containing protein -
IHP09_RS24760 36222..36377 + 156 Protein_33 antirestriction protein -
IHP09_RS24765 36423..36887 + 465 WP_050554502.1 DUF1380 family protein -
IHP09_RS24770 36884..37075 + 192 WP_001027496.1 hypothetical protein -
IHP09_RS24775 37054..37373 - 320 Protein_36 pilus assembly protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..82142 82142
- flank IS/Tn - - 31714..31953 239


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11244.27 Da        Isoelectric Point: 10.4703

>T289629 WP_001270421.1 NZ_LR882059:c32305-32018 [Escherichia coli]
MRYQVKFREDALKEWQKLDKTIQQQFAKKLKKCCDNPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDEQLIIAVVAVGK
RERSDVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9178.47 Da        Isoelectric Point: 4.2108

>AT289629 WP_001132895.1 NZ_LR882059:c32553-32302 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGFPVAILNRNQPAFYCVPAELYEKMLDALDDQELVKLVAERSNQPLHDVDLD
KYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB L4J0V6

References