Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3893488..3894322 | Replicon | chromosome |
Accession | NZ_LR882057 | ||
Organism | Escherichia coli isolate 2014-01-7375 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | IHP09_RS18900 | Protein ID | WP_079399123.1 |
Coordinates | 3893488..3893865 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | IHP09_RS18905 | Protein ID | WP_191536357.1 |
Coordinates | 3893954..3894322 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHP09_RS18870 | 3888563..3888841 | + | 279 | WP_000488407.1 | DUF4222 domain-containing protein | - |
IHP09_RS18875 | 3889040..3890203 | + | 1164 | WP_000051903.1 | site-specific integrase | - |
IHP09_RS18880 | 3890429..3891748 | + | 1320 | WP_000144688.1 | site-specific integrase | - |
IHP09_RS18885 | 3891841..3892689 | - | 849 | WP_134888717.1 | DUF4942 domain-containing protein | - |
IHP09_RS18890 | 3892786..3892983 | - | 198 | WP_000772024.1 | DUF957 domain-containing protein | - |
IHP09_RS18895 | 3893003..3893491 | - | 489 | WP_032215286.1 | hypothetical protein | - |
IHP09_RS18900 | 3893488..3893865 | - | 378 | WP_079399123.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
IHP09_RS18905 | 3893954..3894322 | - | 369 | WP_191536357.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
IHP09_RS18910 | 3894401..3894622 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
IHP09_RS18915 | 3894685..3895161 | - | 477 | WP_001186773.1 | RadC family protein | - |
IHP09_RS18920 | 3895177..3895662 | - | 486 | WP_134888779.1 | antirestriction protein | - |
IHP09_RS18925 | 3895717..3896535 | - | 819 | WP_191536140.1 | DUF945 domain-containing protein | - |
IHP09_RS18930 | 3896635..3896868 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
IHP09_RS18935 | 3896947..3897402 | - | 456 | WP_000581504.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3870955..3943414 | 72459 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14158.21 Da Isoelectric Point: 7.8523
>T289619 WP_079399123.1 NZ_LR882057:c3893865-3893488 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKR
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13621.58 Da Isoelectric Point: 6.4652
>AT289619 WP_191536357.1 NZ_LR882057:c3894322-3893954 [Escherichia coli]
VSDTLPGTILPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFALLMKQLELMLTSG
ELSPRYQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
VSDTLPGTILPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFALLMKQLELMLTSG
ELSPRYQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|