Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3706099..3706936 | Replicon | chromosome |
Accession | NZ_LR882057 | ||
Organism | Escherichia coli isolate 2014-01-7375 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | IHP09_RS17975 | Protein ID | WP_000227784.1 |
Coordinates | 3706394..3706936 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | IHP09_RS17970 | Protein ID | WP_001297137.1 |
Coordinates | 3706099..3706410 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHP09_RS17945 | 3701119..3702066 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
IHP09_RS17950 | 3702088..3704079 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
IHP09_RS17955 | 3704069..3704683 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
IHP09_RS17960 | 3704683..3705012 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
IHP09_RS17965 | 3705024..3705914 | + | 891 | WP_000971336.1 | heme o synthase | - |
IHP09_RS17970 | 3706099..3706410 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
IHP09_RS17975 | 3706394..3706936 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
IHP09_RS17980 | 3706992..3707927 | - | 936 | WP_001297127.1 | sel1 repeat family protein | - |
IHP09_RS17985 | 3708335..3709699 | + | 1365 | WP_001000978.1 | MFS transporter | - |
IHP09_RS17990 | 3709827..3710318 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
IHP09_RS17995 | 3710486..3711397 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T289618 WP_000227784.1 NZ_LR882057:3706394-3706936 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|