Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3670685..3671303 | Replicon | chromosome |
Accession | NZ_LR882057 | ||
Organism | Escherichia coli isolate 2014-01-7375 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | IHP09_RS17800 | Protein ID | WP_001291435.1 |
Coordinates | 3671085..3671303 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | IHP09_RS17795 | Protein ID | WP_000344800.1 |
Coordinates | 3670685..3671059 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHP09_RS17785 | 3665774..3666967 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
IHP09_RS17790 | 3666990..3670139 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
IHP09_RS17795 | 3670685..3671059 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
IHP09_RS17800 | 3671085..3671303 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
IHP09_RS17805 | 3671475..3672026 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
IHP09_RS17810 | 3672142..3672612 | + | 471 | WP_000136192.1 | YlaC family protein | - |
IHP09_RS17820 | 3674112..3675662 | + | 1551 | WP_112044478.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
IHP09_RS17825 | 3675704..3676057 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T289617 WP_001291435.1 NZ_LR882057:3671085-3671303 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT289617 WP_000344800.1 NZ_LR882057:3670685-3671059 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |