Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 2973614..2974449 | Replicon | chromosome |
Accession | NZ_LR882057 | ||
Organism | Escherichia coli isolate 2014-01-7375 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | IHP09_RS14475 | Protein ID | WP_000854768.1 |
Coordinates | 2973614..2973991 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | IHP09_RS14480 | Protein ID | WP_024179191.1 |
Coordinates | 2974081..2974449 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHP09_RS14440 | 2969202..2969756 | - | 555 | WP_001001902.1 | molecular chaperone YcdY | - |
IHP09_RS14445 | 2969780..2970517 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
IHP09_RS14450 | 2970572..2971510 | - | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
IHP09_RS14460 | 2971981..2972823 | - | 843 | WP_072693077.1 | DUF4942 domain-containing protein | - |
IHP09_RS14465 | 2972920..2973117 | - | 198 | WP_000839234.1 | DUF957 domain-containing protein | - |
IHP09_RS14470 | 2973129..2973617 | - | 489 | WP_000761708.1 | hypothetical protein | - |
IHP09_RS14475 | 2973614..2973991 | - | 378 | WP_000854768.1 | TA system toxin CbtA family protein | Toxin |
IHP09_RS14480 | 2974081..2974449 | - | 369 | WP_024179191.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
IHP09_RS14485 | 2974499..2975143 | - | 645 | WP_000086766.1 | hypothetical protein | - |
IHP09_RS14490 | 2975162..2975383 | - | 222 | WP_000692290.1 | DUF987 domain-containing protein | - |
IHP09_RS14495 | 2975452..2975928 | - | 477 | WP_001470113.1 | RadC family protein | - |
IHP09_RS14500 | 2975944..2976429 | - | 486 | WP_000206651.1 | antirestriction protein | - |
IHP09_RS14505 | 2976522..2977340 | - | 819 | WP_080030209.1 | DUF945 domain-containing protein | - |
IHP09_RS14510 | 2977680..2978750 | - | 1071 | WP_086624232.1 | patatin-like phospholipase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14148.25 Da Isoelectric Point: 7.7294
>T289616 WP_000854768.1 NZ_LR882057:c2973991-2973614 [Escherichia coli]
MKTLPDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
GACTCSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
GACTCSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13734.44 Da Isoelectric Point: 5.4970
>AT289616 WP_024179191.1 NZ_LR882057:c2974449-2974081 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|