Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1406422..1407047 | Replicon | chromosome |
Accession | NZ_LR882057 | ||
Organism | Escherichia coli isolate 2014-01-7375 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | IHP09_RS06880 | Protein ID | WP_000911329.1 |
Coordinates | 1406649..1407047 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | IHP09_RS06875 | Protein ID | WP_000450524.1 |
Coordinates | 1406422..1406649 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHP09_RS06850 | 1402224..1402694 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
IHP09_RS06855 | 1402694..1403266 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
IHP09_RS06860 | 1403412..1404290 | + | 879 | WP_075862033.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
IHP09_RS06865 | 1404307..1405341 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
IHP09_RS06870 | 1405554..1406267 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
IHP09_RS06875 | 1406422..1406649 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
IHP09_RS06880 | 1406649..1407047 | + | 399 | WP_000911329.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
IHP09_RS06885 | 1407194..1408057 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
IHP09_RS06890 | 1408072..1410087 | + | 2016 | WP_000829393.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
IHP09_RS06895 | 1410161..1410859 | + | 699 | WP_000679812.1 | esterase | - |
IHP09_RS06900 | 1410969..1411169 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T289609 WP_000911329.1 NZ_LR882057:1406649-1407047 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |