Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 939173..939827 | Replicon | chromosome |
Accession | NZ_LR882057 | ||
Organism | Escherichia coli isolate 2014-01-7375 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A140N853 |
Locus tag | IHP09_RS04620 | Protein ID | WP_000244783.1 |
Coordinates | 939420..939827 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | IHP09_RS04615 | Protein ID | WP_000354046.1 |
Coordinates | 939173..939439 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHP09_RS04595 | 935341..935652 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
IHP09_RS04600 | 935816..936475 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
IHP09_RS04605 | 936598..937578 | - | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
IHP09_RS04610 | 937950..938930 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
IHP09_RS04615 | 939173..939439 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
IHP09_RS04620 | 939420..939827 | + | 408 | WP_000244783.1 | protein YgfX | Toxin |
IHP09_RS04625 | 939867..940388 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
IHP09_RS04630 | 940500..941396 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
IHP09_RS04635 | 941421..942131 | + | 711 | WP_000715216.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
IHP09_RS04640 | 942137..943870 | + | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 936598..937578 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15962.85 Da Isoelectric Point: 11.2669
>T289607 WP_000244783.1 NZ_LR882057:939420-939827 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEISLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEISLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A140N853 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |