Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 832805..833640 Replicon chromosome
Accession NZ_LR882057
Organism Escherichia coli isolate 2014-01-7375

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1C0Y405
Locus tag IHP09_RS04085 Protein ID WP_001774607.1
Coordinates 832805..833182 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M2U6P5
Locus tag IHP09_RS04090 Protein ID WP_001774606.1
Coordinates 833272..833640 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IHP09_RS04060 828878..829861 - 984 WP_001298261.1 KpsF/GutQ family sugar-phosphate isomerase -
IHP09_RS04065 830672..830842 - 171 Protein_798 IS110 family transposase -
IHP09_RS04070 831184..832026 - 843 WP_032152755.1 DUF4942 domain-containing protein -
IHP09_RS04075 832111..832308 - 198 WP_032152719.1 DUF957 domain-containing protein -
IHP09_RS04080 832320..832808 - 489 WP_001774608.1 hypothetical protein -
IHP09_RS04085 832805..833182 - 378 WP_001774607.1 TA system toxin CbtA family protein Toxin
IHP09_RS04090 833272..833640 - 369 WP_001774606.1 type IV toxin-antitoxin system toxin CbtA Antitoxin
IHP09_RS04095 833690..834334 - 645 WP_001774605.1 hypothetical protein -
IHP09_RS04100 834353..834574 - 222 WP_000692312.1 DUF987 domain-containing protein -
IHP09_RS04105 834637..835113 - 477 WP_001297237.1 RadC family protein -
IHP09_RS04110 835129..835608 - 480 WP_032152717.1 antirestriction protein -
IHP09_RS04115 835702..835947 - 246 WP_016238868.1 hypothetical protein -
IHP09_RS04120 835947..836765 - 819 WP_016238867.1 DUF945 domain-containing protein -
IHP09_RS04125 836864..837097 - 234 WP_001278287.1 DUF905 family protein -
IHP09_RS04130 837103..837780 - 678 WP_001097305.1 hypothetical protein -
IHP09_RS04135 837928..838608 - 681 WP_032082725.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - iroB 831057..868567 37510
- flank IS/Tn - - 830672..830827 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14218.20 Da        Isoelectric Point: 7.8045

>T289606 WP_001774607.1 NZ_LR882057:c833182-832805 [Escherichia coli]
MKTLPDTHVREASRCPPPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDTVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.31 Da        Isoelectric Point: 5.8746

>AT289606 WP_001774606.1 NZ_LR882057:c833640-833272 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1C0Y405

Antitoxin

Source ID Structure
AlphaFold DB A0A1M2U6P5

References