Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 291386..292186 | Replicon | chromosome |
| Accession | NZ_LR882057 | ||
| Organism | Escherichia coli isolate 2014-01-7375 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | F4NNI0 |
| Locus tag | IHP09_RS01335 | Protein ID | WP_000342449.1 |
| Coordinates | 291659..292186 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | IHP09_RS01330 | Protein ID | WP_001277108.1 |
| Coordinates | 291386..291652 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IHP09_RS01310 | 287044..287712 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| IHP09_RS01315 | 287705..288763 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| IHP09_RS01320 | 289008..289862 | + | 855 | WP_000130221.1 | RNA polymerase sigma factor RpoH | - |
| IHP09_RS01325 | 290133..291236 | + | 1104 | WP_001350438.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| IHP09_RS01330 | 291386..291652 | + | 267 | WP_001277108.1 | DUF1778 domain-containing protein | Antitoxin |
| IHP09_RS01335 | 291659..292186 | + | 528 | WP_000342449.1 | GNAT family N-acetyltransferase | Toxin |
| IHP09_RS01340 | 292183..292566 | - | 384 | WP_000778781.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| IHP09_RS01345 | 292990..294099 | + | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| IHP09_RS01350 | 294147..295073 | + | 927 | WP_000003004.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| IHP09_RS01355 | 295070..296347 | + | 1278 | WP_000803799.1 | branched chain amino acid ABC transporter permease LivM | - |
| IHP09_RS01360 | 296344..297111 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19691.70 Da Isoelectric Point: 7.7457
>T289604 WP_000342449.1 NZ_LR882057:291659-292186 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLZ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6GTS | |
| PDB | 6AJN | |
| PDB | 6GTQ | |
| PDB | 6GTO | |
| PDB | 6GTR | |
| PDB | 6AJM | |
| AlphaFold DB | A0A829CN24 |