Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 6910..7432 Replicon plasmid 5
Accession NZ_LR882056
Organism Escherichia coli isolate 2015-01-466

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag QREC_RS23380 Protein ID WP_000220560.1
Coordinates 7151..7432 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag QREC_RS23375 Protein ID WP_000121743.1
Coordinates 6910..7161 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QREC_RS23340 1959..2189 + 231 WP_000051064.1 partitioning protein -
QREC_RS23345 2205..2516 + 312 WP_000360321.1 hypothetical protein -
QREC_RS23350 2554..3174 + 621 WP_000342587.1 hypothetical protein -
QREC_RS23355 3199..3833 + 635 Protein_6 hypothetical protein -
QREC_RS23360 3864..4286 - 423 WP_031942371.1 DNA distortion polypeptide 3 -
QREC_RS23365 4354..4800 - 447 WP_001074386.1 hypothetical protein -
QREC_RS23370 4840..5676 - 837 WP_001050931.1 replication initiation protein -
QREC_RS23375 6910..7161 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
QREC_RS23380 7151..7432 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QREC_RS23385 7578..7901 + 324 WP_001181903.1 hypothetical protein -
QREC_RS23390 7946..8191 + 246 WP_000356546.1 hypothetical protein -
QREC_RS23395 8181..8396 + 216 WP_001180116.1 hypothetical protein -
QREC_RS23400 8489..8818 + 330 WP_000866648.1 hypothetical protein -
QREC_RS23405 8861..9040 + 180 WP_000439078.1 hypothetical protein -
QREC_RS23410 9110..9259 + 150 WP_000003880.1 hypothetical protein -
QREC_RS23415 9272..9544 + 273 WP_000160399.1 hypothetical protein -
QREC_RS23420 9801..9875 + 75 Protein_19 DNA distortion polypeptide 3 -
QREC_RS23425 9870..10415 + 546 WP_000757693.1 hypothetical protein -
QREC_RS23430 10418..11584 + 1167 WP_000539530.1 relaxase/mobilization nuclease domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..46065 46065


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T289602 WP_000220560.1 NZ_LR882056:7151-7432 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT289602 WP_000121743.1 NZ_LR882056:6910-7161 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References