Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 104202..104803 Replicon plasmid 2
Accession NZ_LR882053
Organism Escherichia coli isolate 2015-01-466

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag QREC_RS22435 Protein ID WP_191514958.1
Coordinates 104423..104803 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QREC_RS22430 Protein ID WP_001190712.1
Coordinates 104202..104423 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QREC_RS22420 101252..102466 - 1215 WP_025269841.1 restriction endonuclease subunit S -
QREC_RS22425 102463..104019 - 1557 WP_042065480.1 type I restriction-modification system subunit M -
QREC_RS22430 104202..104423 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QREC_RS22435 104423..104803 + 381 WP_191514958.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QREC_RS22440 104808..104987 + 180 WP_001513661.1 hypothetical protein -
QREC_RS22445 105015..105374 + 360 WP_001513660.1 hypothetical protein -
QREC_RS22450 105298..105711 + 414 Protein_129 DDE-type integrase/transposase/recombinase -
QREC_RS22455 105661..105978 - 318 WP_001513659.1 hypothetical protein -
QREC_RS22460 106206..107222 - 1017 WP_191514959.1 IS5-like element IS5 family transposase -
QREC_RS22465 107430..108833 + 1404 WP_191514960.1 S-methylmethionine permease -
QREC_RS22470 108820..109752 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(B) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / aac(3)-IIa / mph(A) / sul1 / aadA5 - 1..113096 113096


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13645.34 Da        Isoelectric Point: 4.8838

>T289599 WP_191514958.1 NZ_LR882053:104423-104803 [Escherichia coli]
MRHISPEELIALHDANINRYDGLPGMSDPGKAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT289599 WP_001190712.1 NZ_LR882053:104202-104423 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References