Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 93739..94264 | Replicon | plasmid 2 |
Accession | NZ_LR882053 | ||
Organism | Escherichia coli isolate 2015-01-466 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QREC_RS22390 | Protein ID | WP_001159868.1 |
Coordinates | 93739..94044 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | QREC_RS22395 | Protein ID | WP_000813634.1 |
Coordinates | 94046..94264 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QREC_RS22375 | 89649..90815 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QREC_RS22380 | 91403..92158 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QREC_RS22385 | 92932..93738 | - | 807 | WP_000016982.1 | site-specific integrase | - |
QREC_RS22390 | 93739..94044 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QREC_RS22395 | 94046..94264 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QREC_RS22400 | 94972..95967 | + | 996 | WP_000246636.1 | hypothetical protein | - |
QREC_RS22405 | 95971..96903 | + | 933 | WP_058682609.1 | hypothetical protein | - |
QREC_RS22410 | 97103..97800 | - | 698 | Protein_121 | IS1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(B) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / aac(3)-IIa / mph(A) / sul1 / aadA5 | - | 1..113096 | 113096 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T289598 WP_001159868.1 NZ_LR882053:c94044-93739 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|