Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 5454525..5455089 | Replicon | chromosome |
| Accession | NZ_LR881952 | ||
| Organism | Streptomyces sp. KY70 isolate Streptomyces sp. KY70 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | STRPST75_RS24300 | Protein ID | WP_076966179.1 |
| Coordinates | 5454742..5455089 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | STRPST75_RS24295 | Protein ID | WP_128848473.1 |
| Coordinates | 5454525..5454755 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STRPST75_RS24280 | 5450532..5451062 | - | 531 | WP_030563750.1 | hypothetical protein | - |
| STRPST75_RS24285 | 5451221..5453797 | - | 2577 | WP_202590841.1 | aminopeptidase N | - |
| STRPST75_RS24290 | 5453922..5454470 | + | 549 | WP_202590840.1 | DUF1203 domain-containing protein | - |
| STRPST75_RS24295 | 5454525..5454755 | + | 231 | WP_128848473.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| STRPST75_RS24300 | 5454742..5455089 | + | 348 | WP_076966179.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| STRPST75_RS24305 | 5455189..5456217 | - | 1029 | WP_030563744.1 | aspartate-semialdehyde dehydrogenase | - |
| STRPST75_RS24310 | 5456422..5456943 | + | 522 | WP_030563742.1 | sigma-70 family RNA polymerase sigma factor | - |
| STRPST75_RS24315 | 5456946..5457596 | + | 651 | WP_076966176.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12796.75 Da Isoelectric Point: 10.9373
>T289557 WP_076966179.1 NZ_LR881952:5454742-5455089 [Streptomyces sp. KY70]
MRRGDIYLIDFEPVRGSEANKARPALIVSNDGANATVERTERGVLTVVPLTSNTARVFPFQVLLPAAECHLSVDSKAQCE
QVRAVSPQRLRRRIGKAPHQRMTEIDAALRRHLAL
MRRGDIYLIDFEPVRGSEANKARPALIVSNDGANATVERTERGVLTVVPLTSNTARVFPFQVLLPAAECHLSVDSKAQCE
QVRAVSPQRLRRRIGKAPHQRMTEIDAALRRHLAL
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|