Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 3659457..3660151 | Replicon | chromosome |
| Accession | NZ_LR881940 | ||
| Organism | Escherichia coli isolate 2015-01-2097 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A2A3UTQ9 |
| Locus tag | IHP11_RS17690 | Protein ID | WP_001094399.1 |
| Coordinates | 3659457..3659825 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | IHP11_RS17695 | Protein ID | WP_077249034.1 |
| Coordinates | 3659846..3660151 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IHP11_RS17670 | 3654968..3656611 | + | 1644 | WP_001310578.1 | fimbrial adhesin EcpD | - |
| IHP11_RS17675 | 3656580..3657290 | + | 711 | WP_001741242.1 | fimbrial chaperone EcpE | - |
| IHP11_RS17680 | 3657603..3657932 | + | 330 | WP_001303809.1 | YkgJ family cysteine cluster protein | - |
| IHP11_RS17685 | 3658113..3658810 | - | 698 | Protein_3461 | IS1-like element IS1A family transposase | - |
| IHP11_RS17690 | 3659457..3659825 | - | 369 | WP_001094399.1 | TA system toxin CbtA family protein | Toxin |
| IHP11_RS17695 | 3659846..3660151 | - | 306 | WP_077249034.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| IHP11_RS17700 | 3660255..3660899 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| IHP11_RS17705 | 3660918..3661139 | - | 222 | WP_191521655.1 | DUF987 domain-containing protein | - |
| IHP11_RS17710 | 3661202..3661678 | - | 477 | WP_001186773.1 | RadC family protein | - |
| IHP11_RS17715 | 3661694..3662179 | - | 486 | WP_001737493.1 | antirestriction protein | - |
| IHP11_RS17720 | 3662271..3663089 | - | 819 | WP_001234749.1 | DUF945 domain-containing protein | - |
| IHP11_RS17725 | 3663180..3663413 | - | 234 | WP_001117560.1 | DUF905 family protein | - |
| IHP11_RS17730 | 3663484..3663714 | - | 231 | Protein_3470 | autotransporter domain-containing protein | - |
| IHP11_RS17735 | 3663798..3664589 | - | 792 | WP_001405552.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13568.73 Da Isoelectric Point: 7.7465
>T289550 WP_001094399.1 NZ_LR881940:c3659825-3659457 [Escherichia coli]
MNTLPATISPAAKPCPSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQVQAPYLTATDILQARKACGLMSRCSYRDVSNIVLSRSRL
MNTLPATISPAAKPCPSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQVQAPYLTATDILQARKACGLMSRCSYRDVSNIVLSRSRL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|