Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3092794..3093499 | Replicon | chromosome |
Accession | NZ_LR881940 | ||
Organism | Escherichia coli isolate 2015-01-2097 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | IHP11_RS14955 | Protein ID | WP_000539521.1 |
Coordinates | 3092794..3093180 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | IHP11_RS14960 | Protein ID | WP_001280945.1 |
Coordinates | 3093170..3093499 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHP11_RS14935 | 3088798..3089424 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
IHP11_RS14940 | 3089421..3090536 | - | 1116 | Protein_2928 | aldose sugar dehydrogenase YliI | - |
IHP11_RS14945 | 3090647..3091030 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
IHP11_RS14950 | 3091243..3092568 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
IHP11_RS14955 | 3092794..3093180 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
IHP11_RS14960 | 3093170..3093499 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
IHP11_RS14965 | 3093569..3094897 | - | 1329 | WP_000086877.1 | GGDEF domain-containing protein | - |
IHP11_RS14970 | 3094905..3097253 | - | 2349 | WP_191521638.1 | EAL domain-containing protein | - |
IHP11_RS14975 | 3097431..3098342 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T289548 WP_000539521.1 NZ_LR881940:3092794-3093180 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|