Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2476483..2477121 | Replicon | chromosome |
Accession | NZ_LR881940 | ||
Organism | Escherichia coli isolate 2015-01-2097 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | IHP11_RS11970 | Protein ID | WP_039000726.1 |
Coordinates | 2476945..2477121 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | IHP11_RS11965 | Protein ID | WP_001270286.1 |
Coordinates | 2476483..2476899 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IHP11_RS11945 | 2471635..2472576 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
IHP11_RS11950 | 2472577..2473590 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
IHP11_RS11955 | 2473608..2474753 | - | 1146 | WP_000047421.1 | ABC transporter substrate-binding protein | - |
IHP11_RS11960 | 2474998..2476404 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
IHP11_RS11965 | 2476483..2476899 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
IHP11_RS11970 | 2476945..2477121 | - | 177 | WP_039000726.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
IHP11_RS11975 | 2477343..2477573 | + | 231 | WP_000494244.1 | YncJ family protein | - |
IHP11_RS11980 | 2477665..2479626 | - | 1962 | WP_191521613.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
IHP11_RS11985 | 2479699..2480235 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
IHP11_RS11990 | 2480288..2481502 | + | 1215 | WP_191521812.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6783.85 Da Isoelectric Point: 11.2298
>T289547 WP_039000726.1 NZ_LR881940:c2477121-2476945 [Escherichia coli]
VKQSEFRRWFESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWFESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT289547 WP_001270286.1 NZ_LR881940:c2476899-2476483 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|