Detailed information of TA system
Overview
TA module
| Type | V | Classification (family/domain) | ghoTS/ghoT-GhoS |
| Location | 4336078..4336575 | Replicon | chromosome |
| Accession | NZ_LR881938 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | ghoT | Uniprot ID | L4JJG6 |
| Locus tag | IEU92_RS20850 | Protein ID | WP_001173343.1 |
| Coordinates | 4336402..4336575 (+) | Length | 58 a.a. |
Antitoxin (Protein)
| Gene name | ghoS | Uniprot ID | L4JK92 |
| Locus tag | IEU92_RS20845 | Protein ID | WP_000398619.1 |
| Coordinates | 4336078..4336374 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IEU92_RS20825 | 4332809..4333528 | - | 720 | WP_000611288.1 | two-component system response regulator DcuR | - |
| IEU92_RS20830 | 4333525..4335156 | - | 1632 | WP_001216477.1 | sensor histidine kinase | - |
| IEU92_RS20835 | 4335337..4335567 | + | 231 | WP_000371704.1 | (4Fe-4S)-binding protein | - |
| IEU92_RS20840 | 4335579..4335851 | + | 273 | WP_000405651.1 | N-acetyltransferase | - |
| IEU92_RS20845 | 4336078..4336374 | + | 297 | WP_000398619.1 | type V toxin-antitoxin system endoribonuclease antitoxin GhoS | Antitoxin |
| IEU92_RS20850 | 4336402..4336575 | + | 174 | WP_001173343.1 | type V toxin-antitoxin system toxin GhoT | Toxin |
| IEU92_RS20855 | 4336694..4338211 | - | 1518 | WP_001295074.1 | lysine--tRNA ligase | - |
| IEU92_RS20860 | 4338448..4339905 | - | 1458 | WP_000856829.1 | dipeptide/tripeptide permease DtpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6555.06 Da Isoelectric Point: 10.2288
>T289529 WP_001173343.1 NZ_LR881938:4336402-4336575 [Escherichia coli str. K-12 substr. MG1655]
MALFSKILIFYVIGVNISFVIIWFISHEKTHIRLLSAFLVGITWPMSLPVALLFSLF
MALFSKILIFYVIGVNISFVIIWFISHEKTHIRLLSAFLVGITWPMSLPVALLFSLF
Download Length: 174 bp
Antitoxin
Download Length: 99 a.a. Molecular weight: 11467.97 Da Isoelectric Point: 4.1705
>AT289529 WP_000398619.1 NZ_LR881938:4336078-4336374 [Escherichia coli str. K-12 substr. MG1655]
MEGKNKFNTYVVSFDYPSSYSSVFLRLRSLMYDMNFSSIVADEYGIPRQLNENSFAITTSLAASEIEDLIRLKCLDLPDI
DFDLNIMTVDDYFRQFYK
MEGKNKFNTYVVSFDYPSSYSSVFLRLRSLMYDMNFSSIVADEYGIPRQLNENSFAITTSLAASEIEDLIRLKCLDLPDI
DFDLNIMTVDDYFRQFYK
Download Length: 297 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QI41 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2LLZ | |
| AlphaFold DB | A0A7U9QBH6 |