Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 2760606..2761273 | Replicon | chromosome |
Accession | NZ_LR881938 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | IEU92_RS13450 | Protein ID | WP_001094400.1 |
Coordinates | 2760944..2761273 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | IEU92_RS13445 | Protein ID | WP_000072690.1 |
Coordinates | 2760606..2760923 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IEU92_RS13415 | 2755658..2756667 | - | 1010 | Protein_2620 | arsenic transporter | - |
IEU92_RS13420 | 2756809..2758512 | + | 1704 | WP_000896263.1 | hypothetical protein | - |
IEU92_RS13425 | 2759084..2759307 | + | 224 | Protein_2622 | DUF905 family protein | - |
IEU92_RS13430 | 2759410..2759868 | + | 459 | WP_000211841.1 | antirestriction protein | - |
IEU92_RS13435 | 2759877..2760359 | + | 483 | WP_001407480.1 | RadC family protein | - |
IEU92_RS13440 | 2760368..2760568 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
IEU92_RS13445 | 2760606..2760923 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
IEU92_RS13450 | 2760944..2761273 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
IEU92_RS13455 | 2761637..2766217 | - | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T289522 WP_001094400.1 NZ_LR881938:2760944-2761273 [Escherichia coli str. K-12 substr. MG1655]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Download Length: 106 a.a. Molecular weight: 11737.27 Da Isoelectric Point: 6.4630
>AT289522 WP_000072690.1 NZ_LR881938:2760606-2760923 [Escherichia coli str. K-12 substr. MG1655]
MSNTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYH
NGFTCEADTLGSCGYVYIAVYPTQR
MSNTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYH
NGFTCEADTLGSCGYVYIAVYPTQR
Download Length: 318 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P52141 |