Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2060605..2061436 Replicon chromosome
Accession NZ_LR881938
Organism Escherichia coli str. K-12 substr. MG1655 strain K-12

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag IEU92_RS10170 Protein ID WP_000854814.1
Coordinates 2061062..2061436 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID P76364
Locus tag IEU92_RS10165 Protein ID WP_001285584.1
Coordinates 2060605..2060973 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IEU92_RS10150 2058272..2059804 + 1533 WP_001350525.1 hypothetical protein -
IEU92_RS10155 2059801..2060247 + 447 WP_000187523.1 RadC family protein -
IEU92_RS10160 2060310..2060531 + 222 WP_000692323.1 DUF987 domain-containing protein -
IEU92_RS10165 2060605..2060973 + 369 WP_001285584.1 type IV toxin-antitoxin system toxin CbtA Antitoxin
IEU92_RS10170 2061062..2061436 + 375 WP_000854814.1 type IV toxin-antitoxin system toxin CbtA Toxin
IEU92_RS10175 2061433..2061627 + 195 WP_000988600.1 hypothetical protein -
IEU92_RS10180 2061640..2061753 + 114 WP_001161660.1 DUF957 domain-containing protein -
IEU92_RS10185 2062042..2062170 - 129 Protein_1988 transposase domain-containing protein -
IEU92_RS10190 2062242..2062424 + 183 WP_001016348.1 hypothetical protein -
IEU92_RS10195 2062525..2062854 - 330 WP_000450409.1 DUF496 family protein -
IEU92_RS10200 2063026..2064084 - 1059 WP_001200891.1 FUSC family protein -
IEU92_RS10205 2064282..2064755 - 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
IEU92_RS10210 2064874..2066040 - 1167 WP_000830156.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T289519 WP_000854814.1 NZ_LR881938:2061062-2061436 [Escherichia coli str. K-12 substr. MG1655]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13651.52 Da        Isoelectric Point: 5.9541

>AT289519 WP_001285584.1 NZ_LR881938:2060605-2060973 [Escherichia coli str. K-12 substr. MG1655]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
PDB 2H28
AlphaFold DB A0A1M2E8G6

References