Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 1493555..1494193 | Replicon | chromosome |
| Accession | NZ_LR881938 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | IEU92_RS07290 | Protein ID | WP_000813794.1 |
| Coordinates | 1493555..1493731 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | IEU92_RS07295 | Protein ID | WP_001270286.1 |
| Coordinates | 1493777..1494193 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IEU92_RS07270 | 1489174..1490388 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
| IEU92_RS07275 | 1490441..1490977 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| IEU92_RS07280 | 1491050..1493011 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| IEU92_RS07285 | 1493103..1493333 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| IEU92_RS07290 | 1493555..1493731 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| IEU92_RS07295 | 1493777..1494193 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| IEU92_RS07300 | 1494272..1495678 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| IEU92_RS07305 | 1495923..1497068 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| IEU92_RS07310 | 1497086..1498099 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| IEU92_RS07315 | 1498100..1499041 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T289512 WP_000813794.1 NZ_LR881938:1493555-1493731 [Escherichia coli str. K-12 substr. MG1655]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT289512 WP_001270286.1 NZ_LR881938:1493777-1494193 [Escherichia coli str. K-12 substr. MG1655]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|