Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 262552..263231 | Replicon | chromosome |
| Accession | NZ_LR881938 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | IEU92_RS01240 | Protein ID | WP_000854672.1 |
| Coordinates | 262552..262893 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | IEU92_RS01245 | Protein ID | WP_000070395.1 |
| Coordinates | 262914..263231 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IEU92_RS01215 | 257829..258230 | + | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
| IEU92_RS01220 | 258269..259324 | - | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| IEU92_RS01225 | 259612..260715 | + | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| IEU92_RS01230 | 260727..261980 | + | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| IEU92_RS01240 | 262552..262893 | - | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| IEU92_RS01245 | 262914..263231 | - | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| IEU92_RS01250 | 263250..263471 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| IEU92_RS01255 | 263480..263956 | - | 477 | WP_000811693.1 | RadC family protein | - |
| IEU92_RS01260 | 263972..264430 | - | 459 | WP_000211838.1 | antirestriction protein | - |
| IEU92_RS01265 | 264528..264767 | - | 240 | WP_000194654.1 | DUF905 domain-containing protein | - |
| IEU92_RS01270 | 264844..265311 | - | 468 | WP_001547765.1 | hypothetical protein | - |
| IEU92_RS01275 | 265334..265777 | - | 444 | WP_000824223.1 | hypothetical protein | - |
| IEU92_RS01280 | 265777..266004 | - | 228 | WP_001548158.1 | hypothetical protein | - |
| IEU92_RS01285 | 266000..266191 | - | 192 | Protein_248 | DeoR family transcriptional regulator | - |
| IEU92_RS01290 | 266408..267229 | - | 822 | WP_000197389.1 | DUF945 domain-containing protein | - |
| IEU92_RS01295 | 267321..268184 | - | 864 | WP_001065553.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T289501 WP_000854672.1 NZ_LR881938:c262893-262552 [Escherichia coli str. K-12 substr. MG1655]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Download Length: 106 a.a. Molecular weight: 11939.59 Da Isoelectric Point: 6.7391
>AT289501 WP_000070395.1 NZ_LR881938:c263231-262914 [Escherichia coli str. K-12 substr. MG1655]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR
Download Length: 318 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|