Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 86817..87574 | Replicon | plasmid pUPC1 |
Accession | NZ_LR881937 | ||
Organism | Enterobacter cancerogenus strain UPC1 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A2J4ZXV7 |
Locus tag | ENTER_RS23075 | Protein ID | WP_029497408.1 |
Coordinates | 86817..87299 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | ENTER_RS23080 | Protein ID | WP_094645258.1 |
Coordinates | 87287..87574 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ENTER_RS23040 | 82041..82571 | - | 531 | WP_202562315.1 | antirestriction protein | - |
ENTER_RS23045 | 83249..84079 | - | 831 | WP_202562316.1 | N-6 DNA methylase | - |
ENTER_RS23050 | 84125..84388 | - | 264 | WP_046622508.1 | hypothetical protein | - |
ENTER_RS23055 | 84474..84830 | - | 357 | WP_063449773.1 | hypothetical protein | - |
ENTER_RS23060 | 84877..85161 | - | 285 | WP_202562383.1 | hypothetical protein | - |
ENTER_RS23065 | 85220..85609 | - | 390 | WP_202562317.1 | ammonia monooxygenase | - |
ENTER_RS23070 | 86310..86468 | - | 159 | WP_202562386.1 | type I toxin-antitoxin system Hok family toxin | - |
ENTER_RS23075 | 86817..87299 | - | 483 | WP_029497408.1 | GNAT family N-acetyltransferase | Toxin |
ENTER_RS23080 | 87287..87574 | - | 288 | WP_094645258.1 | DUF1778 domain-containing protein | Antitoxin |
ENTER_RS23085 | 88022..89500 | + | 1479 | WP_000927305.1 | SulP family inorganic anion transporter | - |
ENTER_RS23090 | 89519..90346 | + | 828 | WP_070715567.1 | universal stress protein | - |
ENTER_RS23100 | 92077..92256 | - | 180 | Protein_81 | theronine dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..121756 | 121756 | |
- | flank | IS/Tn | - | - | 90505..91308 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17599.34 Da Isoelectric Point: 9.8719
>T289498 WP_029497408.1 NZ_LR881937:c87299-86817 [Enterobacter cancerogenus]
VGRLTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLRLP
VGRLTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLRLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|