Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3767977..3768634 | Replicon | chromosome |
| Accession | NZ_LR881936 | ||
| Organism | Enterobacter cancerogenus strain UPC1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A5Q2KE30 |
| Locus tag | ENTER_RS17700 | Protein ID | WP_058608592.1 |
| Coordinates | 3767977..3768387 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W7NX65 |
| Locus tag | ENTER_RS17705 | Protein ID | WP_006178375.1 |
| Coordinates | 3768368..3768634 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ENTER_RS17680 | 3763969..3765702 | - | 1734 | WP_202561089.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| ENTER_RS17685 | 3765708..3766421 | - | 714 | WP_202561090.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| ENTER_RS17690 | 3766450..3767346 | - | 897 | WP_006178372.1 | site-specific tyrosine recombinase XerD | - |
| ENTER_RS17695 | 3767448..3767969 | + | 522 | WP_006178373.1 | flavodoxin FldB | - |
| ENTER_RS17700 | 3767977..3768387 | - | 411 | WP_058608592.1 | protein YgfX | Toxin |
| ENTER_RS17705 | 3768368..3768634 | - | 267 | WP_006178375.1 | FAD assembly factor SdhE | Antitoxin |
| ENTER_RS17710 | 3768929..3769909 | + | 981 | WP_202561091.1 | tRNA-modifying protein YgfZ | - |
| ENTER_RS17715 | 3770008..3770667 | - | 660 | WP_137849902.1 | hemolysin III family protein | - |
| ENTER_RS17720 | 3770934..3771665 | + | 732 | WP_202562269.1 | MurR/RpiR family transcriptional regulator | - |
| ENTER_RS17725 | 3771781..3773214 | + | 1434 | WP_102890244.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16190.97 Da Isoelectric Point: 11.1724
>T289497 WP_058608592.1 NZ_LR881936:c3768387-3767977 [Enterobacter cancerogenus]
VVLWQSELRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDIIGTPWMLNSGMMLRLRSVDGERRQHLWLAADSMDAAEWRDLRRTMLQQPTQD
VVLWQSELRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDIIGTPWMLNSGMMLRLRSVDGERRQHLWLAADSMDAAEWRDLRRTMLQQPTQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Q2KE30 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W7NX65 |