Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1134814..1135434 | Replicon | chromosome |
Accession | NZ_LR881936 | ||
Organism | Enterobacter cancerogenus strain UPC1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | D2ZG55 |
Locus tag | ENTER_RS05380 | Protein ID | WP_006176938.1 |
Coordinates | 1134814..1135032 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | D2ZG56 |
Locus tag | ENTER_RS05385 | Protein ID | WP_006176939.1 |
Coordinates | 1135060..1135434 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ENTER_RS05350 | 1130829..1131089 | + | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
ENTER_RS05355 | 1131092..1131232 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
ENTER_RS05360 | 1131229..1131939 | - | 711 | WP_202561766.1 | GNAT family N-acetyltransferase | - |
ENTER_RS05365 | 1132041..1133501 | + | 1461 | WP_202561767.1 | PLP-dependent aminotransferase family protein | - |
ENTER_RS05370 | 1133452..1133940 | - | 489 | WP_042320836.1 | membrane protein | - |
ENTER_RS05375 | 1134057..1134608 | - | 552 | WP_202561768.1 | maltose O-acetyltransferase | - |
ENTER_RS05380 | 1134814..1135032 | - | 219 | WP_006176938.1 | hemolysin expression modulator Hha | Toxin |
ENTER_RS05385 | 1135060..1135434 | - | 375 | WP_006176939.1 | Hha toxicity modulator TomB | Antitoxin |
ENTER_RS05390 | 1135945..1139091 | - | 3147 | WP_137271695.1 | multidrug efflux RND transporter permease subunit AcrB | - |
ENTER_RS05395 | 1139114..1140307 | - | 1194 | WP_006176941.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T289491 WP_006176938.1 NZ_LR881936:c1135032-1134814 [Enterobacter cancerogenus]
MSEKPLTKIDYLMRLRRCQSLDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSEKPLTKIDYLMRLRRCQSLDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14467.25 Da Isoelectric Point: 4.8886
>AT289491 WP_006176939.1 NZ_LR881936:c1135434-1135060 [Enterobacter cancerogenus]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFINASRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFINASRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|