Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
Location | 645413..646207 | Replicon | chromosome |
Accession | NZ_LR881936 | ||
Organism | Enterobacter cancerogenus strain UPC1 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | D2ZA23 |
Locus tag | ENTER_RS03095 | Protein ID | WP_006174149.1 |
Coordinates | 645413..645934 (-) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | D2ZA22 |
Locus tag | ENTER_RS03100 | Protein ID | WP_006174147.1 |
Coordinates | 645938..646207 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ENTER_RS03070 | 640740..640901 | + | 162 | WP_058609595.1 | DUF1127 domain-containing protein | - |
ENTER_RS03075 | 640986..642374 | - | 1389 | WP_202561619.1 | PLP-dependent aminotransferase family protein | - |
ENTER_RS03080 | 642476..642955 | + | 480 | WP_006174154.1 | carboxymuconolactone decarboxylase family protein | - |
ENTER_RS03085 | 642942..643844 | - | 903 | WP_202561620.1 | LysR family transcriptional regulator | - |
ENTER_RS03090 | 643945..645360 | + | 1416 | WP_202561621.1 | aldehyde dehydrogenase family protein | - |
ENTER_RS03095 | 645413..645934 | - | 522 | WP_006174149.1 | GNAT family N-acetyltransferase | Toxin |
ENTER_RS03100 | 645938..646207 | - | 270 | WP_006174147.1 | DUF1778 domain-containing protein | Antitoxin |
ENTER_RS03105 | 646549..647019 | + | 471 | WP_058609602.1 | MarR family transcriptional regulator | - |
ENTER_RS03110 | 647016..648083 | + | 1068 | WP_088208796.1 | HlyD family secretion protein | - |
ENTER_RS03115 | 648073..649149 | + | 1077 | WP_006174141.1 | DUF2955 domain-containing protein | - |
ENTER_RS03120 | 649119..650417 | - | 1299 | WP_202561622.1 | DUF445 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19728.67 Da Isoelectric Point: 7.3189
>T289490 WP_006174149.1 NZ_LR881936:c645934-645413 [Enterobacter cancerogenus]
VNDVKIGIFSEDVEYDLSQFDCGEVSLNTFLAEHLKRQHRGKFLRAYVLTTREENPRVLGYYTLSGSCFEKAYLPSKTQQ
KRIPYKNVPSVTLGRLAIDKRIQGQGFGELLVTHAMKTVYLASFAVGIHGLFVEALNDTARNFYLKLGFIPLLAENEFTL
FLPTKTFESMFEE
VNDVKIGIFSEDVEYDLSQFDCGEVSLNTFLAEHLKRQHRGKFLRAYVLTTREENPRVLGYYTLSGSCFEKAYLPSKTQQ
KRIPYKNVPSVTLGRLAIDKRIQGQGFGELLVTHAMKTVYLASFAVGIHGLFVEALNDTARNFYLKLGFIPLLAENEFTL
FLPTKTFESMFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|