Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 620829..621607 Replicon chromosome
Accession NZ_LR881936
Organism Enterobacter cancerogenus strain UPC1

Toxin (Protein)


Gene name ypjF Uniprot ID A0A3U1V6G9
Locus tag ENTER_RS02960 Protein ID WP_033805147.1
Coordinates 621233..621607 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3U1V6I4
Locus tag ENTER_RS02955 Protein ID WP_033805146.1
Coordinates 620829..621194 (+) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ENTER_RS02910 616124..616828 + 705 WP_202561604.1 WYL domain-containing protein -
ENTER_RS02915 616828..617397 + 570 WP_202562219.1 hypothetical protein -
ENTER_RS02920 617434..617886 + 453 WP_033805139.1 hypothetical protein -
ENTER_RS02925 617883..618332 + 450 WP_033805140.1 hypothetical protein -
ENTER_RS02930 618404..618634 + 231 WP_033805141.1 DUF905 domain-containing protein -
ENTER_RS02935 618736..619556 + 821 Protein_568 DUF945 domain-containing protein -
ENTER_RS02940 619587..620030 + 444 WP_181041937.1 antirestriction protein -
ENTER_RS02945 620043..620585 + 543 WP_202561605.1 DNA repair protein RadC -
ENTER_RS02950 620582..620803 + 222 WP_202561606.1 DUF987 domain-containing protein -
ENTER_RS02955 620829..621194 + 366 WP_033805146.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ENTER_RS02960 621233..621607 + 375 WP_033805147.1 TA system toxin CbtA family protein Toxin
ENTER_RS02965 621904..622773 - 870 Protein_574 HNH endonuclease -
ENTER_RS02970 623073..623525 + 453 WP_202561607.1 SymE family type I addiction module toxin -
ENTER_RS02975 623634..624380 - 747 WP_202561608.1 class I SAM-dependent methyltransferase -
ENTER_RS02980 624391..624648 - 258 WP_202561609.1 YjhX family toxin -
ENTER_RS02985 624958..625437 - 480 WP_042319349.1 type VI secretion system tube protein Hcp -
ENTER_RS02990 625440..625787 - 348 WP_202561610.1 hypothetical protein -
ENTER_RS02995 625780..626463 - 684 WP_202561611.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 610713..628399 17686


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(17-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13843.88 Da        Isoelectric Point: 7.9537

>T289489 WP_033805147.1 NZ_LR881936:621233-621607 [Enterobacter cancerogenus]
MQTISSHLTRAAQPCLSPVEIWQLLLTHLLSQHYGLTLNDTPFSDETTIQKHIDAGISLSDAVNFLVEKYELIRIDRDGC
SVMAQKSPFITSIDILRARKASGLMKRSSHKTVTRATAGQHQEL

Download         Length: 375 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13393.06 Da        Isoelectric Point: 5.0700

>AT289489 WP_033805146.1 NZ_LR881936:620829-621194 [Enterobacter cancerogenus]
MNNHSESGAIPENPPCQQWGLKSTITPCFGARLVQEGDRLHFLADRAGFNGAFSDEHALRLDQAFPLILKQLELMLTSGE
LNPRHPHSVTLYHNGLTCEADTLGSCGYVFIAIYPEQTEPQ

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3U1V6G9

Antitoxin

Source ID Structure
AlphaFold DB A0A3U1V6I4

References